PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G027697_P01
Common NameZm.13902
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 281aa    MW: 31898.3 Da    PI: 4.9848
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G027697_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.15.5e-201663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed+llv++v+q+G g+W+++a+  g++R++k+c++rw +yl
  GRMZM2G027697_P01 16 KGPWTAQEDKLLVEYVRQHGEGRWNSVAKLTGLKRSGKSCRLRWVNYL 63
                       79********************************************97 PP

2Myb_DNA-binding50.93.6e-1669113147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  GRMZM2G027697_P01  69 RGKITPQEESVILQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 113
                        8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6521163IPR017930Myb domain
SuperFamilySSF466891.61E-3014110IPR009057Homeodomain-like
SMARTSM007174.0E-171565IPR001005SANT/Myb domain
PfamPF002498.8E-191663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-241770IPR009057Homeodomain-like
CDDcd001678.67E-131863No hitNo description
PROSITE profilePS5129424.47564118IPR017930Myb domain
SMARTSM007174.4E-1568116IPR001005SANT/Myb domain
PfamPF002496.4E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-2471116IPR009057Homeodomain-like
CDDcd001675.03E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009089anatomyendosperm
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDGQFGWGRE EGGWRKGPWT AQEDKLLVEY VRQHGEGRWN SVAKLTGLKR SGKSCRLRWV  60
NYLRPDLKRG KITPQEESVI LQLHALWGNR WSTIARSLPG RTDNEIKNYW RTHFKKAKPS  120
KNVERARARF LKQRREMQSQ LLLLQGQDQH RQEEEQPDHD DDGASEATPG VPLEEEEEQQ  180
QQQHEDLRMM LQQDMDDLLF QFCPMASCTS SSCLLPGGGS CASVVSASAS EDGSSGDHQL  240
DGAATWGWGS LWNLDDVVDD VDGGAWDSSF SFLQDQGLAF Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261611627126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G027697
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G027697_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-137AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-137AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008645936.10.0PREDICTED: myb-related protein 308
TrEMBLA0A096Q7H50.0A0A096Q7H5_MAIZE; Uncharacterized protein
STRINGGRMZM2G027697_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.18e-66myb domain protein 79
Publications ? help Back to Top
  1. Rabinowicz PD,Braun EL,Wolfe AD,Bowen B,Grotewold E
    Maize R2R3 Myb genes: Sequence analysis reveals amplification in the higher plants.
    Genetics, 1999. 153(1): p. 427-44
    [PMID:10471724]